DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and RBM28

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_060547.2 Gene:RBM28 / 55131 HGNCID:21863 Length:759 Species:Homo sapiens


Alignment Length:620 Identity:122/620 - (19%)
Similarity:225/620 - (36%) Gaps:211/620 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KTPKAKESEKAELKP------------------------------IKKEP-------------GV 23
            |.||||:::.|:.|.                              |.::|             .:
Human   100 KEPKAKKAKVADKKARLIIRNLSFKCSEDDLKTVFAQFGAVLEVNIPRKPDGKMRGFGFVQFKNL 164

  Fly    24 VEDGKVTKKSKTKP-KKKTV----KVPKDEVKAAVQESPKKLSAKDLAKIEKKKAKKQAQKLKKQ 83
            :|.||..|....|. |.:||    .|.||:.|     ..:.:||....|..:.|.::..:|..::
Human   165 LEAGKALKGMNMKEIKGRTVAVDWAVAKDKYK-----DTQSVSAIGEEKSHESKHQESVKKKGRE 224

  Fly    84 QNKLAPKE--------------IKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKK--- 131
            :..:..:|              ...|.|.:..:|||.||..:::|.....|........|::   
Human   225 EEDMEEEENDDDDDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKSSDHSEEDSD 289

  Fly   132 -------------AKANANNKDEE-------GVKRIRNPAE--EASTVFVGNLPINTKRVQLVKL 174
                         |:::.:.:::|       ..|:.:.|::  |..|||:.||..:::..:|.:|
Human   290 LEESDSIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEELGEL 354

  Fly   175 FQPYGLVQSIRL---------------------------------RTAGG--------------- 191
            .|.:|.::.:|:                                 ..|||               
Human   355 LQQFGELKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAASPENEAGGLKLDGRQLKVDLAVT 419

  Fly   192 ----KQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMA--EKFGQAKD 250
                .:|...|.:|..|:.|.|       :|::.|...|::..|.   |:.|.||  |:|...|.
Human   420 RDEAAKLQTTKVKKPTGTRNLY-------LAREGLIRAGTKAAEG---VSAADMAKRERFELLKH 474

  Fly   251 KQPSDKDAKRTIFVG-------SLKYSATEEQLREIFSSC--GE----IDYIRCLQD-----GD- 296
            ::..|::    |||.       :|..:..::|||::..|.  ||    |...|.::|     |: 
Human   475 QKLKDQN----IFVSRTRLCLHNLPKAVDDKQLRKLLLSATSGEKGVRIKECRVMRDLKGVHGNM 535

  Fly   297 KG-CKGVAYVCFQKPDAVGLALEL----------------NQTLLDDRPINVERYQVKKLGAKQV 344
            || ..|.|:..||:.:....||.|                ..:|.|.|.:.::..:::: ..:::
Human   536 KGQSLGYAFAEFQEHEHALKALRLINNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQR-SLQKM 599

  Fly   345 RDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSLKKEGAP--TGQKKKSEYRGVKVDG 407
            |...|.....| .....||:|....|:...:::........:|.|:.  ||.:.|:|...|::..
Human   600 RSKPATGEPQK-GQPEPAKDQQQKAAQHHTEEQSKVPPEQKRKAGSTSWTGFQTKAEVEQVELPD 663

  Fly   408 IKKAKK---------PKKKSNDQQTALAKKIAPKQ 433
            .||.:|         ||.:..|:  ...|.:.||:
Human   664 GKKRRKVLALPSHRGPKIRLRDK--GKVKPVHPKK 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/133 (17%)
RRM_SF 261..332 CDD:302621 26/106 (25%)
RBM28NP_060547.2 RRM1_RBM28_like 5..81 CDD:240859
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..105 3/4 (75%)
RRM2_RBM28_like 115..190 CDD:240860 10/74 (14%)
RRM 126..721 CDD:330708 115/594 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..330 20/128 (16%)
RRM3_RBM28_like 335..417 CDD:240861 13/81 (16%)
RRM4_RBM28_like 487..581 CDD:240862 21/93 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..759 23/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.