DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and cirbp

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:140 Identity:33/140 - (23%)
Similarity:63/140 - (45%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 IFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD-KGCKGVAYVCFQKP-DAVGLALELNQTLL 324
            :|||.|.:..|||.|.::||..|::..:..::|.: |..:|..:|.|:.| ||....:.:|...:
 Frog     8 LFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSV 72

  Fly   325 DDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQ-NSAGAKKRLDKKKGKENGSLKKE 388
            |.|.|.|::                   |.|:|:..:...: .|:|.:......:|:..|..:..
 Frog    73 DGRQIRVDQ-------------------AGKSSNDRRGGYRGGSSGGRGFFRGGRGRGGGGDRGY 118

  Fly   389 GAPTGQKKKS 398
            |..:..:.:|
 Frog   119 GGSSRFENRS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840
RRM_SF 261..332 CDD:302621 23/71 (32%)
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 25/95 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 14/80 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.