DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and celf1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_012816629.1 Gene:celf1 / 549906 XenbaseID:XB-GENE-854036 Length:534 Species:Xenopus tropicalis


Alignment Length:273 Identity:63/273 - (23%)
Similarity:102/273 - (37%) Gaps:68/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSI- 184
            |..|   ||||.....::.|        :|..::..:|||.:|.:....:|.:||:.||.|..| 
 Frog    20 NSSP---VSKKMNGTMDHPD--------HPDPDSIKMFVGQVPRSWSEKELRELFEQYGAVYEIN 73

  Fly   185 --RLRTAGGKQ-----LFKHKQRKVAGSLNAYVVLEKPEIAQQAL----ALNGSEFKENHLRVTP 238
              |.|:....|     ......||.|        ||    ||.||    .|.|   ..:.:::.|
 Frog    74 VLRDRSQNPPQSKGCCFITFYTRKAA--------LE----AQNALHNMKVLPG---MHHPIQMKP 123

  Fly   239 ASMAEKFGQAK----DKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGC 299
            |...:..|...    .:.|:..: .|.:|||.:.....|..:|.:||..|:|:..|.|:..|...
 Frog   124 ADSEKNNGGLNTVLYPEHPASVE-DRKLFVGMVSKKCNENDIRAMFSQFGQIEESRILRGPDGMS 187

  Fly   300 KGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKN 364
            :|.|:|.|.......:|                   :|.:...|..:..::....|.:...|.|.
 Frog   188 RGCAFVTFTTRSMAQMA-------------------IKAMHQAQTMEGCSSPIVVKFADTQKDKE 233

  Fly   365 QNSAGAKKRLDKK 377
            |      ||:.::
 Frog   234 Q------KRMTQQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 25/93 (27%)
RRM_SF 261..332 CDD:302621 17/70 (24%)
celf1XP_012816629.1 RRM1_CELF1_2_Bruno 42..125 CDD:241075 26/97 (27%)
ELAV_HUD_SF 45..529 CDD:273741 55/237 (23%)
RRM2_CELF1_2 147..227 CDD:241078 21/98 (21%)
RRM3_CELF1_2 442..533 CDD:241082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.