DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and SF2

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster


Alignment Length:259 Identity:58/259 - (22%)
Similarity:97/259 - (37%) Gaps:53/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 VFVGNLP--INTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQ 219
            ::|||||  |.||.:|  .||..:|.|..:.|:...|...             |:|..|....|.
  Fly     9 IYVGNLPPDIRTKDIQ--DLFHKFGKVTFVDLKNRRGPPF-------------AFVEFEDARDAD 58

  Fly   220 QAL-ALNGSEFKENHLRVT------PASMAEKFGQAKDKQ-----------PSDKDAKRTIFVGS 266
            .|: |.:|.::....|||.      |.|.  :.|...|:.           |..|.::..:.|..
  Fly    59 DAVKARDGYDYDGYRLRVEFPR
GGGPGSY--RGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTG 121

  Fly   267 LKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINV 331
            |..|.:.:.|::.....|::    |..|..|...||  |.|.:.:.:..|::    .|||.....
  Fly   122 LPASGSWQDLKDHMREAGDV----CFADTYKDGSGV--VEFLRHEDMKYAIK----KLDDSRFRS 176

  Fly   332 ERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKR--LDKKKGKENGSL-KKEGAPT 392
            ...:|..:   :||:.:..:........:......|.|...|  .|:.:.:...|. ::.|.||
  Fly   177 HEGEVAYI---RVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/82 (29%)
RRM_SF 261..332 CDD:302621 16/70 (23%)
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 25/85 (29%)
RRM2_SRSF1_like 115..188 CDD:410013 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.