DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Hnrnpdl

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_057899.2 Gene:Hnrnpdl / 50926 MGIID:1355299 Length:420 Species:Mus musculus


Alignment Length:378 Identity:71/378 - (18%)
Similarity:140/378 - (37%) Gaps:67/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KAAVQESPKKLSAKDLAKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEK 114
            :...:.||:.::|:..:::....|.|..::.:....:...|....:..|.....::..::..:..
Mouse    51 RQGARRSPRHVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAGTRTARQHPLAD 115

  Fly   115 EPTTAPNEKPKGKVSKKA---KANAN-NKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLF 175
            ...|..:......:.:.|   |.||: |:.::|            .:|:|.|..:|.:..|.:..
Mouse   116 GSATMEDMNEYSNIEEFAEGSKINASKNQQDDG------------KMFIGGLSWDTSKKDLTEYL 168

  Fly   176 QPYGLVQSIRLRT---AGGKQLFKHKQRKVAGSLNAYVVLEKPEI------AQQALALNGSEFKE 231
            ..:|.|....::|   .|..:.|.....|.|.|::..:.|::.::      .::|.||.|     
Mouse   169 SRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKG----- 228

  Fly   232 NHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD 296
                               |:|..|     :|||.|....:|||::|.|.:.|||:.|....|..
Mouse   229 -------------------KEPPKK-----VFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTK 269

  Fly   297 KG-CKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRD-----AAAASAASK 355
            .. .:|..::.:...:.|...||.....:......::..|.|::..:|.:.     .|||.....
Mouse   270 TNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGG 334

  Fly   356 TSSKTKAKNQN-SAGAKKRLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDG 407
            ...:.:.:.|| :.|.....|:..|..|      .|..|.:..|.|.|....|
Mouse   335 ARGRGRGQGQNWNQGFNNYYDQGYGNYN------SAYGGDQNYSGYGGYDYTG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 18/90 (20%)
RRM_SF 261..332 CDD:302621 18/71 (25%)
HnrnpdlNP_057899.2 RRM1_hnRPDL 149..224 CDD:241202 14/74 (19%)
RRM2_hnRPDL 234..308 CDD:241029 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.