DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Boll

DIOPT Version :10

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001419438.1 Gene:Boll / 501143 RGDID:1559527 Length:340 Species:Rattus norvegicus


Alignment Length:71 Identity:19/71 - (26%)
Similarity:35/71 - (49%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 IFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQ-KPDAVGLALELNQTLLD 325
            ||||.:.:...|..||:.||..|.:..::.:.|.....||..::.|: :.||..:..|..:....
  Rat    47 IFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQEDAQKILQEAEKLNYK 111

  Fly   326 DRPINV 331
            |:.:|:
  Rat   112 DKKLNI 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828
RRM_SF 261..332 CDD:473069 19/71 (27%)
BollNP_001419438.1 RRM_BOULE 43..123 CDD:410074 19/71 (27%)
PABP-1234 <45..293 CDD:130689 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.