powered by:
Protein Alignment CG12288 and msi1
DIOPT Version :9
Sequence 1: | NP_609822.1 |
Gene: | CG12288 / 35027 |
FlyBaseID: | FBgn0032620 |
Length: | 435 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012816886.1 |
Gene: | msi1 / 496961 |
XenbaseID: | XB-GENE-490596 |
Length: | 347 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 35/72 - (48%) |
Gaps: | 5/72 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 IFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD---KGCKGVAYVCFQKPDAVGLALELNQTL 323
:|:|.|.:..|:|.|||.||..|::. .||...| |..:|..:|.|.....|...|..::..
Frog 22 MFIGGLSWQTTQEGLREYFSHFGDVK--ECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHE 84
Fly 324 LDDRPIN 330
||.:.|:
Frog 85 LDSKTID 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.