DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and hnrnpc

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_012815605.1 Gene:hnrnpc / 448664 XenbaseID:XB-GENE-489141 Length:343 Species:Xenopus tropicalis


Alignment Length:326 Identity:63/326 - (19%)
Similarity:115/326 - (35%) Gaps:104/326 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINT---KRVQLVKLFQPY 178
            |||....|.   |....:|..||.:        |....|.||:|||  ||   |:..:..:|..|
 Frog    50 TTAKIASPG---SDMMASNVTNKTD--------PRSMNSRVFIGNL--NTLVVKKADVEAIFSKY 101

  Fly   179 GLVQSIRLRTAGGKQLFKHKQRK-----VAGSLNAYVVLEKPEIAQQALALN-GSEFKENHLRV- 236
            |.:....:..  |....::...:     |||.       :...||.|.:.:| .:|.|.|..:. 
 Frog   102 GKIVGCSVHK--GYAFVQYSNERNARTAVAGE-------DGRMIAGQVMDINLAAEPKANRSKTG 157

  Fly   237 TPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKG 301
            ...|.|:.:|.:.|   .:.|.:|..:.   .||||.                            
 Frog   158 VKRSAADMYGSSFD---LEYDFQRDYYD---SYSATR---------------------------- 188

  Fly   302 VAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQN 366
                 ...|..:..|:                     :.:|:.|.:..||...|:...:|:..:.
 Frog   189 -----VPPPPPIARAV---------------------VPSKRQRVSGNASRRGKSGFNSKSGQRG 227

  Fly   367 SAGAKKRLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKS----NDQQTALAK 427
            .:....||   ||.:..::|||.:...|:..|     .::.:::.::.:.|.    :::|::|:.
 Frog   228 GSSKSSRL---KGDDLQAIKKELSQIKQRVDS-----LLENLERIEREQSKQDIKLDEEQSSLST 284

  Fly   428 K 428
            |
 Frog   285 K 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/91 (25%)
RRM_SF 261..332 CDD:302621 6/70 (9%)
hnrnpcXP_012815605.1 RRM_hnRNPC 76..146 CDD:241047 20/80 (25%)
APG6_N <229..322 CDD:375248 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.