DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and pabpc1l

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001005062.1 Gene:pabpc1l / 448615 XenbaseID:XB-GENE-5742459 Length:629 Species:Xenopus tropicalis


Alignment Length:337 Identity:69/337 - (20%)
Similarity:128/337 - (37%) Gaps:105/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRL-------RTAGGKQLFKHKQRKVAGSLNAYVVL 212
            ::::||:|..:.....|.:.|.|.|.:.|||:       |:.|                .||:..
 Frog    11 ASLYVGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLG----------------YAYINF 59

  Fly   213 EKPEIAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPS-DKDAKRTIFVGSLKYSATEEQ 275
            ::|..|::|| .:|....|...:|:          ....:.|. .|.....:|:.:|..|...:.
 Frog    60 QQPADAERALDTMNFEVIKGRPIRI----------MWSQRDPGLRKSGVGNVFIKNLDESIDNKA 114

  Fly   276 LREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERYQ---- 335
            |.:.||:.|.|...:.:.| :.|.:|..:|.|:..:|...|:: :|..||:||.:.|..::    
 Frog   115 LYDTFSAFGNILSCKVVCD-EHGSRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVGHFKSRRE 178

  Fly   336 ----------------VKKLGA----KQVRDAAAA----------------------------SA 352
                            :|..|.    |::|:..:|                            ..
 Frog   179 RELEYGAKVMEFTNVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMDDTGRSRGFGFVNYGNHEE 243

  Fly   353 ASKTSSKTKAKNQNS-----AGAKKRLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKV------D 406
            |.|..|:...|..|.     ..|:||::::     |.||::.....|::.:.|:||.:      |
 Frog   244 AQKAVSEMNGKEVNGRMIYVGRAQKRIERQ-----GELKRKFEQIKQERINRYQGVNLYVKNLDD 303

  Fly   407 GIKKAKKPKKKS 418
            ||...:..|:.|
 Frog   304 GIDDDRLRKEFS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 21/89 (24%)
RRM_SF 261..332 CDD:302621 20/71 (28%)
pabpc1lNP_001005062.1 PABP-1234 11..612 CDD:130689 69/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.