DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and rbm34

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001004890.1 Gene:rbm34 / 448232 XenbaseID:XB-GENE-5895036 Length:412 Species:Xenopus tropicalis


Alignment Length:415 Identity:128/415 - (30%)
Similarity:189/415 - (45%) Gaps:86/415 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TKKSKTKPKKKTVKVPKDEVKAAVQESPKKLSAKDLAKIEKKKAKKQAQKLKKQQNKLAPKEIKT 94
            ||....:|....||:||.::..|.....||...:.:.|.:..|.|    :|...:.|||.:|   
 Frog    57 TKGPAVQPVYVPVKIPKRKLPEAEGADVKKACKETVVKAKVTKEK----ELSVSEKKLADRE--- 114

  Fly    95 EPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNK-DEEGV-----KRIRNPAEE 153
              ::....:.:.|:|..:.||               |.|:..|.. |::||     ||..|.|||
 Frog   115 --QSLANADEEETRKNVISKE---------------KLKSKKNQSLDDDGVVVQPRKRKVNRAEE 162

  Fly   154 ----ASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAG---------- 204
                ..||||||||.:..:..|..||:.:|.::|:|.|:....:  .:..||||.          
 Frog   163 RIKNKRTVFVGNLPADYTKQMLKSLFKEFGHIESMRFRSVARAE--ANLSRKVAAIQRKVHPKRK 225

  Fly   205 SLNAYVVLEKPEIAQQALALNGSEFKEN-HLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLK 268
            ::|||:|.:....|.|||..||:|.... |:||..||           :.|..|.||:.|:|:|.
 Frog   226 NINAYIVFKDESSASQALKRNGAEVGSGFHIRVDIAS-----------KRSSHDNKRSAFIGNLP 279

  Fly   269 YSATEEQLREIFSSCGEIDYIRCLQDGDKGC-KGVAYVCFQKPDAVGLALELNQTLLDDRPINVE 332
            |...||.:|:.||.||::..:|.::|...|. ||..||.|:..|||.|||:||.:.|..|.|.|:
 Frog   280 YEIEEEAVRDHFSECGKVQGVRIIRDQKTGIGKGFGYVLFESADAVQLALKLNNSELSGRKIRVK 344

  Fly   333 RYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLD---KKKGKENGSLKKEGAPTGQ 394
            |             :..|.||.|:::|       |:..||:||   :.|..:..|...|.|..|:
 Frog   345 R-------------SLTAEAAQKSTNK-------SSDFKKKLDTLKQAKPLKGNSFVGETAEVGK 389

  Fly   395 KKKSEYRGVKVDGIKKAKKPKKKSN 419
            .|...::..|    ||....|||.|
 Frog   390 VKNKGHKNKK----KKTVGNKKKKN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 32/92 (35%)
RRM_SF 261..332 CDD:302621 30/71 (42%)
rbm34NP_001004890.1 RRM1_RBM34 168..259 CDD:240840 32/92 (35%)
RRM2_RBM34 272..344 CDD:240841 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10552
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4422
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004008
OrthoInspector 1 1.000 - - oto104272
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R827
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.