DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and elavl1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001005461.1 Gene:elavl1 / 448062 XenbaseID:XB-GENE-481800 Length:326 Species:Xenopus tropicalis


Alignment Length:245 Identity:57/245 - (23%)
Similarity:95/245 - (38%) Gaps:63/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAG-SLN-AYVVLEKPEI 217
            :.:.|..||.|..:.:|..||...|.|:|.:|           .:.|||| ||. .:|.....:.
 Frog    20 TNLIVNYLPQNMTQDELRSLFSSIGEVESAKL-----------IRDKVAGHSLGYGFVNYLNAKD 73

  Fly   218 AQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFS 281
            |::|: .|||...:...::|:         .|:....|.|||  .:::..|..:.|::.:.::|.
 Frog    74 AERAINTLNGLRLQSKTIKVS---------VARPSSESIKDA--NLYISGLPRTMTQKDVEDMFL 127

  Fly   282 SCGEIDYIRCLQDGDKG-CKGVAYVCFQK---------------------PDAVGLALELNQ--- 321
            ..|.|...|.|.|...| .:|||::.|.|                     |..|..|...||   
 Frog   128 PFGRIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPITVKFAANPNQNKN 192

  Fly   322 -TLLDD----------RPIN--VERYQVKKLGAKQVRDAAAASAASKTSS 358
             .||..          .|::  .:|::...:|...:...:..:.||..||
 Frog   193 MALLSQLCHSPARRFGGPVHHQAQRFRFSPMGVDHMSSISGVNVASSASS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/84 (27%)
RRM_SF 261..332 CDD:302621 22/108 (20%)
elavl1NP_001005461.1 RRM 19..326 CDD:330708 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.