DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and sap-49

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001379265.1 Gene:sap-49 / 4363023 WormBaseID:WBGene00004723 Length:388 Species:Caenorhabditis elegans


Alignment Length:203 Identity:57/203 - (28%)
Similarity:84/203 - (41%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRL---RTAGGKQLFKHKQRKVAGSLNAYVVLEKPE 216
            :|::||.|........|.:|....|.|.|:.:   |.....|.|            .:|.....|
 Worm    13 ATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGF------------GFVEFMGEE 65

  Fly   217 IAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIF 280
            .|..|: .||..:.....::|..||..||          :.|....||||:|.....|:.|.:.|
 Worm    66 DADYAIKILNMIKLYGKPIKVNKASAHEK----------NMDVGANIFVGNLDPEVDEKLLYDTF 120

  Fly   281 SSCGEIDYI-RCLQDGDKG-CKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERYQVKKLGAK 342
            |:.|.|..: :.::|.|.| .||.|::.|...:|...||| :|...|.:|.|.|. |..|: .:|
 Worm   121 SAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALEAMNGQFLCNRAITVS-YAFKR-DSK 183

  Fly   343 QVRDAAAA 350
            ..|...||
 Worm   184 GERHGTAA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 18/85 (21%)
RRM_SF 261..332 CDD:302621 26/73 (36%)
sap-49NP_001379265.1 RRM1_SF3B4 15..88 CDD:409771 18/84 (21%)
RRM2_SF3B4 99..181 CDD:409772 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.