Sequence 1: | NP_609822.1 | Gene: | CG12288 / 35027 | FlyBaseID: | FBgn0032620 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001379265.1 | Gene: | sap-49 / 4363023 | WormBaseID: | WBGene00004723 | Length: | 388 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 57/203 - (28%) |
---|---|---|---|
Similarity: | 84/203 - (41%) | Gaps: | 31/203 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRL---RTAGGKQLFKHKQRKVAGSLNAYVVLEKPE 216
Fly 217 IAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIF 280
Fly 281 SSCGEIDYI-RCLQDGDKG-CKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERYQVKKLGAK 342
Fly 343 QVRDAAAA 350 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12288 | NP_609822.1 | RRM1_RBM34 | 155..237 | CDD:240840 | 18/85 (21%) |
RRM_SF | 261..332 | CDD:302621 | 26/73 (36%) | ||
sap-49 | NP_001379265.1 | RRM1_SF3B4 | 15..88 | CDD:409771 | 18/84 (21%) |
RRM2_SF3B4 | 99..181 | CDD:409772 | 29/83 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |