DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Elavl4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_006238653.1 Gene:Elavl4 / 432358 RGDID:1560027 Length:393 Species:Rattus norvegicus


Alignment Length:222 Identity:51/222 - (22%)
Similarity:95/222 - (42%) Gaps:37/222 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEAST- 156
            :|...|.:..|..:|.:.:|...||:..:..|          ::||::.....:.....:::.| 
  Rat     6 RTLNAALLNNEIISTMEPQVSNGPTSNTSNGP----------SSNNRNCPSPMQTGAATDDSKTN 60

  Fly   157 VFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAY--VVLEKPEIAQ 219
            :.|..||.|..:.:...||...|.::|.:|           .:.|:.|....|  |....|:.|:
  Rat    61 LIVNYLPQNMTQEEFRSLFGSIGEIESCKL-----------VRDKITGQSLGYGFVNYIDPKDAE 114

  Fly   220 QAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSC 283
            :|: .|||...:...::|:         .|:....|.:||  .::|..|..:.|:::|.::||..
  Rat   115 KAINTLNGLRLQTKTIKVS---------YARPSSASIRDA--NLYVSGLPKTMTQKELEQLFSQY 168

  Fly   284 GEIDYIRCLQDGDKG-CKGVAYVCFQK 309
            |.|...|.|.|...| .:||.::.|.|
  Rat   169 GRIITSRILVDQVTGVSRGVGFIRFDK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 20/85 (24%)
RRM_SF 261..332 CDD:302621 16/50 (32%)
Elavl4XP_006238653.1 ELAV_HUD_SF 56..392 CDD:273741 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.