DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and sqd

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:213 Identity:51/213 - (23%)
Similarity:86/213 - (40%) Gaps:24/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LNGSEFKENHLRVTPASMAEKFGQA------KDKQPS---DKDAKRTIFVGSLKYSATEEQLREI 279
            :||.:|.::.....|.|.....|.|      .|.|.:   .:|..|.:|||.|.:..||::||:.
  Fly    11 INGEDFTKDVTADGPGSENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDH 75

  Fly   280 FSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQ 343
            |...|||:.|....|...| .:|.|::.|...:|:.     ..:..|:..||.::...||..|:.
  Fly    76 FGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAID-----KVSAADEHIINSKKVDPKKAKARH 135

  Fly   344 VRDAAAASAASKTSSKTK---AKNQNSAGAKKRLDKKKGKENG----SLKKEGAPTGQKK--KSE 399
            .:..........:..:.|   .:..|....:...||:|.:..|    :...|...|...|  |.:
  Fly   136 GKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQK 200

  Fly   400 YRGVKVDGIKKAKKPKKK 417
            ..|.:||..:...||:.:
  Fly   201 IAGKEVDVKRATPKPENQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 3/12 (25%)
RRM_SF 261..332 CDD:302621 22/71 (31%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 22/75 (29%)
RRM2_hnRNPD_like 137..211 CDD:240775 13/73 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.