DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and hnrnpdl

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001315423.1 Gene:hnrnpdl / 406701 ZFINID:ZDB-GENE-040426-2717 Length:296 Species:Danio rerio


Alignment Length:240 Identity:59/240 - (24%)
Similarity:97/240 - (40%) Gaps:52/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KVEKEPTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLF 175
            :.|::...:.:|.|:|     :|.||:...|:..|           :|:|.|..:|.:..|....
Zfish     2 QAEEQGDFSTDEFPEG-----SKINASKNQEDDGK-----------MFIGGLSWDTSKKDLTDYL 50

  Fly   176 QPYGLVQSIRLRT---AGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVT 237
            ..:|.|....::|   .|..:.|            .:|:.:..|...:.|.|  :|.|.:...:.
Zfish    51 SRFGEVLDCTIKTDPLTGRSRGF------------GFVLFKDAESVDRVLEL--TEHKLDGKLID 101

  Fly   238 PASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKG 301
            |    ::....|.|:|..|     :|||.|....|||||||.|...|||:.|....|.... .:|
Zfish   102 P----KRAKAIKGKEPPKK-----VFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRG 157

  Fly   302 VAYVCFQKPDAVGLALELNQTLLDDR--PINVERYQVKKLGAKQV 344
            ..:|.|...:.|       |.||::|  .|...:.::|....|:|
Zfish   158 FCFVTFALEEPV-------QKLLENRYHQIGSGKCEIKVAQPKEV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/84 (19%)
RRM_SF 261..332 CDD:302621 26/73 (36%)
hnrnpdlNP_001315423.1 RRM1_hnRPDL 31..106 CDD:241202 18/103 (17%)
RRM2_hnRPDL 116..190 CDD:241029 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.