DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and rbm39a

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001012304.1 Gene:rbm39a / 406251 ZFINID:ZDB-GENE-040426-2852 Length:523 Species:Danio rerio


Alignment Length:341 Identity:85/341 - (24%)
Similarity:141/341 - (41%) Gaps:58/341 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KDEVKAA-----VQESPKKLSAKDLAKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESK 105
            ||:.|:.     .:.|.||..:|..::...:|..|..::.|....:.:....:....::.:..|:
Zfish    17 KDDNKSLSTNGHEERSKKKKRSKSRSRSRDRKRSKSRERKKSHDRRRSRSRDRKRSRSKERRRSR 81

  Fly   106 ATKKEKVEKEPTTAP------NEKPKG--------KVSKKAKANAN--NKDEEGVKR-IRN--PA 151
            :..:|:..:  ..||      |..|:|        |:|::...:.:  .||...|:: |.|  |.
Zfish    82 SRSRERGGR--YRAPFSGLKFNGGPRGKTGPPPAIKLSRRRSRSRSPFKKDRSPVRQPIDNLTPE 144

  Fly   152 E-EASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKP 215
            | :|.|||...|....:...|.:.|...|.|:.:|:       :.....|:..|.  ||:.....
Zfish   145 ERDARTVFCMQLAARIRPRDLEEFFSAVGKVRDVRI-------ISDRNSRRSKGI--AYIEFVDS 200

  Fly   216 EIAQQALALNGSEFKENHLRVTPASMAEK---FGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLR 277
            .....|:.|:|.......: :..||.|||   ...|.:.|.......| ::||||.::.||:.||
Zfish   201 TSVPLAIGLSGQRLLGVPI-IVQASQAEKNRAAALANNLQKGSAGPMR-LYVGSLHFNITEDMLR 263

  Fly   278 EIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINV----ERYQV 336
            .||...|.||.|:.:.|.:.| .||..::.|...:....||| ||...|..||:.|    ||   
Zfish   264 GIFEPFGRIDSIQLMMDSETGRSKGYGFITFSDAECAKKALEQLNGFELAGRPMKVGHVTER--- 325

  Fly   337 KKLGAKQVRDAAAASA 352
                    .||:.||:
Zfish   326 --------TDASTASS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/81 (20%)
RRM_SF 261..332 CDD:302621 28/76 (37%)
rbm39aNP_001012304.1 SF-CC1 91..511 CDD:273721 73/265 (28%)
RRM1_RBM39 148..232 CDD:240980 22/93 (24%)
RRM2_RBM23_RBM39 248..320 CDD:240730 27/71 (38%)
RBM39linker 337..432 CDD:292157
RRM3_RBM39_like 416..500 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.