DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and rbm14b

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:183 Identity:55/183 - (30%)
Similarity:86/183 - (46%) Gaps:39/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 VFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQA 221
            :|||||.::|.:.:|..:|:.||.|.|..:.    :|.             |:|.|:....|::|
Zfish     9 LFVGNLALDTTQEELSAIFESYGQVVSCSVL----RQF-------------AFVHLQGEGAAERA 56

  Fly   222 L-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGE 285
            : .|||.|||..:| |...|........|            :|||:|....|.|.|:|:|.:.|:
Zfish    57 IRELNGREFKGRNL-VVEES
RGRPLHSTK------------VFVGNLSSMCTTEDLQELFQTFGK 108

  Fly   286 IDYIRCLQDGDKGCKGVAYVCFQ-KPDAVGLALELNQTLLDDRPINVERYQVK 337
            :  :.|    || .||.|:|..: |.||:.....|:.|....||::||..:|:
Zfish   109 V--LEC----DK-VKGYAFVHMENKEDALQAIEALHGTSFKGRPLSVELSKVQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 25/80 (31%)
RRM_SF 261..332 CDD:302621 24/71 (34%)
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 26/83 (31%)
RRM1_2_CoAA_like 84..149 CDD:240789 25/83 (30%)
AIR1 <150..>187 CDD:331526 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.