DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and cocoon

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:190 Identity:44/190 - (23%)
Similarity:66/190 - (34%) Gaps:56/190 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DEEGVKRIRNPAEEASTVFVGNLP-------------INTKRVQLVKLFQPYGLVQSIRLRTAGG 191
            ::||.:.|..||||..|:.:..|.             ::||.|:.|              |:..|
  Fly     8 EKEGDEPIELPAEEDGTLLLSTLQAQFPESSGLQYRNVDTKAVRGV--------------RSNEG 58

  Fly   192 KQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFK----ENHLRVTPASMAEKFGQAKDKQ 252
            : |:...:....|..:.:.|..|....|....|..|..|    |.|||..               
  Fly    59 R-LYSPSEETGWGEYHYFCVFPKKNKRQSEDNLENSTAKTKRTEAHLRCF--------------- 107

  Fly   253 PSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPD 311
                    .:.|..|.|:.||:.|||.|.:.|::......:|...| .||..:|.|...|
  Fly   108 --------DLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 20/98 (20%)
RRM_SF 261..332 CDD:302621 17/52 (33%)
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 17/52 (33%)
RRM2_TDP43 193..262 CDD:240768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.