DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and ncoa5

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_988936.1 Gene:ncoa5 / 394533 XenbaseID:XB-GENE-5926600 Length:625 Species:Xenopus tropicalis


Alignment Length:461 Identity:82/461 - (17%)
Similarity:164/461 - (35%) Gaps:129/461 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KEPGVVEDGKVTKKSKTKPKKKTVKVPKD--EVKAAVQESPKKLSAK-----------DLAKIEK 70
            :||..:.|.:.|::.:   ..::|:.|:|  :::..:.:..:.|...           |..:.:.
 Frog   100 REPRDLRDPRDTRELR---DSRSVRDPRDARDIRDPLYDRYRDLRDTRDPLYRRDEHFDRYRPDD 161

  Fly    71 KKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKE-----PTTAPNEKPKG---- 126
            ...||....|.:.::.|.....:.||:   :::.:..::|::.::     ......|:|..    
 Frog   162 LYRKKDDILLDRYRDTLDRPLREPEPD---RLKREERRREELYRQYFDEIQRRVDAERPVDCSVV 223

  Fly   127 KVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGG 191
            .|:|::|..|    |...:::|:.......:|     :||:          ..|.|::...|.||
 Frog   224 VVNKQSKEYA----ESVGRKVRDLGMMVDLIF-----LNTE----------VSLTQALEDVTRGG 269

  Fly   192 KQ-------------------LF----KHKQRKVAGSLNAYVVL--------------EKPEIAQ 219
            ..                   ||    :|:...:|   :|.|::              |:.:||:
 Frog   270 SPFAIVITQQHQVHRSCTVNILFGTPQEHRNMPLA---DAMVLIARNYERFKSETREKEREDIAR 331

  Fly   220 QALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCG 284
            ||..::........     |.:||:..:.    |:....:..:.:.:.....|.|::.::     
 Frog   332 QAAKMSADAILRER-----ALLAEEVVRG----PAPPGIQAVLGLLADNRYVTVEEIDKV----- 382

  Fly   285 EIDYIRCLQDGDKGC-------------KGVAYVCFQKPDAVGL----ALELNQTLLDDRP---- 328
             |.|:|..::...|.             .|.|.|........||    ||::.||:....|    
 Frog   383 -IHYLRDKKERLLGAPSDSLPSQLSRPSMGAAPVSSLDNQTSGLANNPALQMTQTISSASPAGQS 446

  Fly   329 INV--ERYQVKKLGAKQVRDAAAASA---ASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSLKKE 388
            :|.  :..|.|.|.......|..||:   ||.|.:.....|| |.|......::.|:.|.|....
 Frog   447 VNTSQQELQAKILSLFNSGSAVGASSNSPASSTPASGSVSNQ-SFGNMPNTQQRPGQINTSAMVS 510

  Fly   389 GAPTGQ 394
            .|...|
 Frog   511 SAQRPQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 19/118 (16%)
RRM_SF 261..332 CDD:302621 17/93 (18%)
ncoa5NP_988936.1 PRK12678 <5..>152 CDD:237171 8/54 (15%)
dermokine <395..>589 CDD:416092 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.