DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and tial1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_005156854.1 Gene:tial1 / 394107 ZFINID:ZDB-GENE-040426-1547 Length:399 Species:Danio rerio


Alignment Length:224 Identity:52/224 - (23%)
Similarity:82/224 - (36%) Gaps:46/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 TVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVL-------- 212
            |::||||..:.....:::||...|..:|.::.|..     ....||:..|...:.||        
Zfish     9 TLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEQ-----SDSSRKMNSSSIGFSVLQHTSNDPY 68

  Fly   213 ------EKPEIAQQALALNGSEFKENHLRV----TPASMAEKFGQAKDKQPSDKDAKRTIFVGSL 267
                  |..:.|....|:||.:.....::|    ||:|           |..|......:|||.|
Zfish    69 CFVEFFEHRDAAAALAAMNGRKILGKEVKVNWATTPSS-----------QKKDTSNHFHVFVGDL 122

  Fly   268 KYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCF-----------QKPDAVGLALELN 320
            ....|.:.:|..|:..|:|...|.::|...| .||..:|.|           :..||....:.:.
Zfish   123 SPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLVRLQYRNRVKDAENAIVHMG 187

  Fly   321 QTLLDDRPINVERYQVKKLGAKQVRDAAA 349
            ...|..|.|.......|....|.|:|.:|
Zfish   188 GQWLGGRQIRTNWATRKPPAPKSVQDNSA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 21/98 (21%)
RRM_SF 261..332 CDD:302621 21/82 (26%)
tial1XP_005156854.1 RRM 7..295 CDD:223796 52/224 (23%)
RRM_SF 9..108 CDD:302621 24/114 (21%)
RRM2_TIAR 114..203 CDD:241061 21/88 (24%)
RRM3_TIAR 233..305 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.