DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and hnrnpa1a

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_021335234.1 Gene:hnrnpa1a / 393467 ZFINID:ZDB-GENE-040426-1546 Length:445 Species:Danio rerio


Alignment Length:274 Identity:57/274 - (20%)
Similarity:108/274 - (39%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGL 180
            |...|.::.:.:.:...:..|.:|:::   ..|.| |:...:|:|.|...|....|...|:.:|.
Zfish     3 PAITPKKEREAESAVSHRVTAMSKEQQ---TPREP-EQLRKLFIGGLSFETTDESLRAHFEQWGT 63

  Fly   181 VQSIRLRTAGGKQLFKHKQR---KVAGSLNAYVVLEKP--------------EIAQQALALNGSE 228
            :....:..:....:..:::.   ||||.|....|:..|              .:.:...|::...
Zfish    64 LTDCVVSPSAAIHMLMYEREEHLKVAGFLYCSQVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARP 128

  Fly   229 FKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCL- 292
            .|.:...|.|.....:...:|   |......:.:|||.:|....||.|||.|...|:||.:..: 
Zfish   129 HKVDGRAVEPKRAVSREDSSK---PGAHSTVKKMFVGGIKEDTDEEHLREYFGQFGKIDEVNIMT 190

  Fly   293 -QDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKT 356
             ::.||. :|.|::.|...|||            || |.:::|........:||.|.:....::.
Zfish   191 EKNSDKR-RGFAFITFDDHDAV------------DR-IVIQKYHTVNGHNCEVRKALSREEMNRV 241

  Fly   357 SSKTKAKNQNSAGA 370
            |..::.......|:
Zfish   242 SMNSRGGRGGGGGS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/98 (16%)
RRM_SF 261..332 CDD:302621 24/72 (33%)
hnrnpa1aXP_021335234.1 RRM_SF 36..144 CDD:327398 18/107 (17%)
RRM_SF 157..233 CDD:327398 27/89 (30%)
HnRNPA1 376..>392 CDD:314495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.