DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and PABPN1L

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001372638.1 Gene:PABPN1L / 390748 HGNCID:37237 Length:297 Species:Homo sapiens


Alignment Length:333 Identity:66/333 - (19%)
Similarity:107/333 - (32%) Gaps:89/333 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNKDEEG-------VKRIRN 149
            :.::||||.......||:       ...| |..:||..|:.:.:| .:|::|       :....|
Human    21 VSSDPEAQGWGAWNETKE-------ILGP-EGGEGKEEKEEEEDA-EEDQDGDAGFLLSLLEQEN 76

  Fly   150 PAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEK 214
            .||         .|:..:.::.:|:                          ||.....|......
Human    77 LAE---------CPLPDQELEAIKM--------------------------KVCAMEQAEGTPRP 106

  Fly   215 PEIAQQALALNGSEFKENHLRVTPASM-AEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLRE 278
            |.:.|||....|:...:   .::|.:: ....|..::|..:|   .|:::||:|       .|..
Human   107 PGVQQQAEEEEGTAAGQ---LLSPETVGCPLSGTPEEKVEAD---HRSVYVGNL-------CLHR 158

  Fly   279 IFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDD-----RPINVERYQVKK 338
            :           |.|....|.:|........|...| |.|.||...|.     .|....|.|...
Human   159 V-----------CHQGLRAGRRGAGPEPLPGPGHQG-AAEKNQLPWDQLHRPRGPSRTPRLQGGT 211

  Fly   339 LGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSLKK-------EGAPTGQKK 396
            |..::....|.|..........|.........|.|.|.::|.......|       .||.:|...
Human   212 LPPQRPPGQAPAQTTRAEPGPWKILTMVFTVLKGRPDFERGAGAWIRSKPLVLHPGAGAGSGAGA 276

  Fly   397 KSEYRGVK 404
            :.|.|||:
Human   277 RPEERGVQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 10/81 (12%)
RRM_SF 261..332 CDD:302621 16/75 (21%)
PABPN1LNP_001372638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..66 14/53 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..128 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.