DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and CG3594

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:100/260 - (38%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 KRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVA---GSL 206
            ||::....:.|...:||.....:|    ::|:              |..:.|...|..:   .|.
  Fly    18 KRVQRTVNDDSADLLGNFDDQKRR----EIFE--------------GTYVDKEDGRNPSDPEDSK 64

  Fly   207 NAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPS------DKDAKRTIFVG 265
            :........|.|.:..|.:|:|.:|:         ||. ||....|.|      .|..:..::|.
  Fly    65 SEDEAKSDDEAAAEGSAASGAEEEES---------AEN-GQITSDQLSSLLRGASKTNRHVLYVT 119

  Fly   266 SLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPIN 330
            :|.:..|::.|...||:.|.:..||..:   |...|.|:|......:...|.:|:.|.|..|.|.
  Fly   120 NLNFETTKDDLELHFSAAGTVKSIRIPK---KRRGGFAFVEMADLSSFQNAFQLHNTELQGRNIK 181

  Fly   331 VERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENG-----SLKKEGA 390
            |           |:.:|....:|:|   |...|.:|...|:.|.::|...::|     .||||.|
  Fly   182 V-----------QISEAGKKKSANK---KNIIKQKNRKLAEMRNEQKTFTKSGKFYDKDLKKEKA 232

  Fly   391  390
              Fly   233  232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 15/84 (18%)
RRM_SF 261..332 CDD:302621 19/70 (27%)
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2864
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.