DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and tra2

DIOPT Version :10

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:92 Identity:23/92 - (25%)
Similarity:45/92 - (48%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 AKDKQPSDK-----DAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD-KGCKGVAYVC 306
            ::|::...|     .|.|.|.|..|..:.::.::||:|:..|.|:.|:.:.|.. :..:|..::.
  Fly    80 SRDRERMHKSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIY 144

  Fly   307 FQK-PDAVGLALELNQTLLDDRPINVE 332
            |:| .||.......:...:|.|.|.|:
  Fly   145 FEKLSDARAAKDSCSGIEVDGRRIRVD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828
RRM_SF 261..332 CDD:473069 18/72 (25%)
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 20/76 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.