DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Elavl1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001102318.1 Gene:Elavl1 / 363854 RGDID:1308649 Length:326 Species:Rattus norvegicus


Alignment Length:248 Identity:57/248 - (22%)
Similarity:96/248 - (38%) Gaps:69/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAG-SLN-AYVVLEKPEI 217
            :.:.|..||.|..:.:|..||...|.|:|.:|           .:.|||| ||. .:|.....:.
  Rat    20 TNLIVNYLPQNMTQEELRSLFSSIGEVESAKL-----------IRDKVAGHSLGYGFVNYVTAKD 73

  Fly   218 AQQALA-LNGSEFKENHLRVTPASMAEKFGQAKDKQPSD---KDAKRTIFVGSLKYSATEEQLRE 278
            |::|:: |||...:...::|:.|            :||.   |||  .:::..|..:.|::.:.:
  Rat    74 AERAISTLNGLRLQSKTIKVSYA------------RPSSEVIKDA--NLYISGLPRTMTQKDVED 124

  Fly   279 IFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQK---------------------PDAVGLALELNQ 321
            :||..|.|...|.|.|...| .:|||::.|.|                     |..|..|...||
  Rat   125 MFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQ 189

  Fly   322 ----TLLDD----------RPIN--VERYQVKKLGAKQVRDAAAASAASKTSS 358
                .||..          .|::  .:|::...:|...:...:..:.....||
  Rat   190 NKNMALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGISGVNVPGNASS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/84 (27%)
RRM_SF 261..332 CDD:302621 23/108 (21%)
Elavl1NP_001102318.1 ELAV_HUD_SF 19..326 CDD:273741 57/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.