DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Syncrip

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001382580.1 Gene:Syncrip / 363113 RGDID:1305683 Length:623 Species:Rattus norvegicus


Alignment Length:427 Identity:94/427 - (22%)
Similarity:157/427 - (36%) Gaps:117/427 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KDEVKAAVQESPKKLSAKDLAKIEKKKA-----KKQAQKLKKQQNKLAPKEIKTEPEAQVKVESK 105
            :|...|.:|:    ....||:.::.|.|     .|..::.:||..|:|... |...||::|.   
  Rat    70 EDGALAVLQQ----FKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSS-KGPDEAKIKA--- 126

  Fly   106 ATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEA----------STVFVG 160
            ..::.....:.||                        |.::...|..::          :.:|||
  Rat   127 LLERTGYTLDVTT------------------------GQRKYGGPPPDSVYSGQQPSVGTEIFVG 167

  Fly   161 NLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLN---AYVVLEKPEIAQQAL 222
            .:|.:....:||.||:..|.:..:||           ....:.| ||   |:|.....|.||:|:
  Rat   168 KIPRDLFEDELVPLFEKAGPIWDLRL-----------MMDPLTG-LNRGYAFVTFCTKEAAQEAV 220

  Fly   223 AL-NGSEFKE-NHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSC-- 283
            .| |..|.:. .|:.|..:.                 |...:||||:..|.|:||:.|.||..  
  Rat   221 KLYNNHEIRSGKHIGVCISV-----------------ANNRLFVGSIPKSKTKEQILEEFSKVTE 268

  Fly   284 GEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDR--------------PINVERY 334
            |..|.|...|..||  |.....||.:.:....|.:..:.|:..:              ||.....
  Rat   269 GLTDVILYHQPDDK--KKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDP 331

  Fly   335 QVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSL---KKEGAPTGQKK 396
            :|    ..:|:.....:.|:..:.:...|:.:..|..:|:  ||.|:...:   :::||   .|.
  Rat   332 EV----MAKVKVLFVRNLANTVTEEILEKSFSQFGKLERV--KKLKDYAFIHFDERDGA---VKA 387

  Fly   397 KSEYRGVKVDG----IKKAKKP--KKKSNDQQTALAK 427
            ..|..|..::|    |..||.|  |:|....|...||
  Rat   388 MEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/86 (28%)
RRM_SF 261..332 CDD:302621 24/86 (28%)
SyncripNP_001382580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.