DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Rrp7a

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001124040.1 Gene:Rrp7a / 362967 RGDID:1311547 Length:280 Species:Rattus norvegicus


Alignment Length:212 Identity:52/212 - (24%)
Similarity:81/212 - (38%) Gaps:49/212 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 AKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD---------------KGCKG--VAYV 305
            |.||:|:.::....|:|.|....||||.|..:...:..|               |...|  ||||
  Rat    57 ANRTLFILNVPPYCTQESLSRCLSSCGTIKTVELQEKPDLAESPKEPKSQFFHPKPVPGFQVAYV 121

  Fly   306 CFQKPDAVGLALELNQTLL---DDRPIN------VERYQVKKLGAKQVR---DAAAASAASK-TS 357
            .||||..|..||.|...||   :..|:.      :..|:...|..:.:|   |....:...| ..
  Rat   122 VFQKPGGVSAALNLKGPLLVSTESHPVKNGIHKWISDYEDSVLDPEALRLEVDTFMEAYDKKIAE 186

  Fly   358 SKTKAKNQNSA------------GAKKRLDKKKGKENGSLKKEGAPTGQKK-----KSEYRGVKV 405
            .:||||.:...            |.:..|.:.:......|:||.....:|:     ..::|..|:
  Rat   187 EETKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLEKERRKRARKELLSFYAWQHRETKM 251

  Fly   406 DGIKKAKKPKKKSNDQQ 422
            :.:  |:..||...|:|
  Rat   252 EHL--AQLRKKFEEDKQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840
RRM_SF 261..332 CDD:302621 28/96 (29%)
Rrp7aNP_001124040.1 RRM_Rrp7A 59..159 CDD:240740 29/99 (29%)
RRP7_Rrp7A 151..280 CDD:240578 22/118 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.