DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Rbm39

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_006235393.1 Gene:Rbm39 / 362251 RGDID:1310071 Length:530 Species:Rattus norvegicus


Alignment Length:377 Identity:86/377 - (22%)
Similarity:148/377 - (39%) Gaps:75/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKTPKAKESEKAELKPIKKEPGVVEDGKVTKKSKTKPKKKTVKVPKDEVKAAVQESPKKLSAKDL 65
            ::.|..|:..|     :....|..|..|..||||::.:....|..|.:                 
  Rat    11 LEAPYKKDENK-----LNSANGHEERSKKRKKSKSRSRSHERKRSKSK----------------- 53

  Fly    66 AKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAP--NEKPKGKV 128
               |:|:::.:.:|..|.:.:   |..:::...:.:..|:..:.....:.|.:.|  |...:||:
  Rat    54 ---ERKRSRDRERKKSKSRER---KRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKI 112

  Fly   129 S-----KKAKANANNKD--EEGVKRIRNPAE-------EASTVFVGNLPINTKRVQLVKLFQPYG 179
            .     |.::..:.:|.  .:....:|.|.:       :|.|||...|....:...|.:.|...|
  Rat   113 GLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVG 177

  Fly   180 LVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEK 244
            .|:.:|:       :.....|:..|.  |||..........|:.|.|.......: :..||.|||
  Rat   178 KVRDVRM-------ISDRNSRRSKGI--AYVEFVDVSSVPLAIGLTGQRVLGVPI-IVQASQAEK 232

  Fly   245 ---FGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYV 305
               ...|.:.|.......| ::||||.::.||:.||.||...|.|:.|:.:.|.:.| .||..::
  Rat   233 NRAAAMANNLQKGSAGPMR-LYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFI 296

  Fly   306 CFQKPDAVGLALE-LNQTLLDDRPINV----ERYQVKKLGAKQVRDAAAASA 352
            .|...:....||| ||...|..||:.|    ||           .||::||:
  Rat   297 TFSDSECAKKALEQLNGFELAGRPMKVGHVTER-----------TDASSASS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 17/81 (21%)
RRM_SF 261..332 CDD:302621 27/76 (36%)
Rbm39XP_006235393.1 SF-CC1 46..518 CDD:273721 76/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.