DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Pabp2

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:248 Identity:56/248 - (22%)
Similarity:92/248 - (37%) Gaps:58/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQR 200
            |...:|||..:| :|..||....|..:....:::                      ||:.....:
  Fly    29 ATEVEEEGSMQI-DPELEAIKARVKEMEEEAEKI----------------------KQMQSEVDK 70

  Fly   201 KVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVG 265
            ::||                     ||   ...|...|.|:.|       ||..|   .|:::||
  Fly    71 QMAG---------------------GS---TTGLATVPLSLEE-------KQEID---TRSVYVG 101

  Fly   266 SLKYSATEEQLREIFSSCGEIDYIRCL-QDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPI 329
            ::.|.|:.|:|...|..||.|:.:..| ...|...||.||:.|...:.|..||.:|:||...|.|
  Fly   102 NVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQI 166

  Fly   330 NVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKEN 382
            .|...:..:.|.......|..|...:.:..::|...::....:|....:|:.|
  Fly   167 KVMSKRTNRPGLSTTNRFARGSFRGRGARVSRACCHSTFRGARRAMGYRGRAN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 8/81 (10%)
RRM_SF 261..332 CDD:302621 25/71 (35%)
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 43/184 (23%)
RRM_II_PABPN1 97..172 CDD:240994 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.