DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Caper

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:113/271 - (41%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KIEKKKAKKQAQKLKKQQNK-LAP-KEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVS 129
            ::::.:.|::..:.:.||.| |:| :|.|         .|.:..:::         |.:.:|..|
  Fly   165 QVDRSRDKRRRSRSRDQQRKRLSPIRERK---------RSHSRSRDR---------NSRRRGTNS 211

  Fly   130 KKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQL 194
            .:.::..|..|......:.....:|.|||...|....:...|.:.|...|.|:.:||.|....:.
  Fly   212 PRRRSPPNGADRTTPTELSPEERDARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKR 276

  Fly   195 FKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRV--TPASMAEKFGQAKDKQPSDKD 257
            ||.         .||:..:.||....||.|:|.......:.|  |.|........|...||....
  Fly   277 FKG---------IAYIEFDDPESVALALGLSGQRLLGVPIMVQHTQAEKNRLQNAAPAFQPKSHT 332

  Fly   258 AKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALE-LN 320
            ....::||||.::.||:.||.||...|:||.|:.:.|.:.| .||..::.:...|....||| ||
  Fly   333 GPMRLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLN 397

  Fly   321 QTLLDDRPINV 331
            ...|..|.:.|
  Fly   398 GFELAGRLMKV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/83 (27%)
RRM_SF 261..332 CDD:302621 27/73 (37%)
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 21/80 (26%)
RRM2_RBM23_RBM39 337..409 CDD:240730 27/72 (38%)
RBM39linker 425..500 CDD:292157
RRM3_RBM39_like 483..567 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.