DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Hrb27C

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:188 Identity:50/188 - (26%)
Similarity:83/188 - (44%) Gaps:26/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 DKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRC--LQDGDKG-CKGVAYVCFQKPDAVGLA 316
            ::|.:..:|||.|.:..|:|.|...|...|:|  |.|  :::.:.| .:|..:|.|..|..|...
  Fly     2 EEDERGKLFVGGLSWETTQENLSRYFCRFGDI--IDCVVMKNNESGRSRGFGFVTFADPTNVNHV 64

  Fly   317 LE-----LNQTLLDDRPINVERYQ-VKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRL- 374
            |:     |:...:|.:|.|....| .||.|..:|......|..::|..:|..   |..|....: 
  Fly    65 LQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFF---NRYGKVTEVV 126

  Fly   375 -----DKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDG----IKKAKKPKKKSNDQQT 423
                 :|||.:..|.|..|...:.:...:| |.:.::|    |||| :|:..|..|.:
  Fly   127 IMYDQEKKKSRGFGFLSFEEESSVEHVTNE-RYINLNGKQVEIKKA-EPRDGSGGQNS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840
RRM_SF 261..332 CDD:302621 23/78 (29%)
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 23/82 (28%)
RRM2_DAZAP1 94..173 CDD:240773 20/83 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.