DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and CG9107

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_608981.1 Gene:CG9107 / 33843 FlyBaseID:FBgn0031764 Length:266 Species:Drosophila melanogaster


Alignment Length:249 Identity:58/249 - (23%)
Similarity:99/249 - (39%) Gaps:72/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LRVTPAS-------MAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRC 291
            ||.||.:       |.|.|.:..|   .:|...||:|:.::....||:.||.:|...|.|:.:..
  Fly    12 LRTTPKAQHCHSIYMREHFIRLMD---PNKPKGRTLFLLNVPPYVTEDSLRTVFGRAGSIEAVEF 73

  Fly   292 L-----QDGDKGCKG---------------VAYVCFQKPDAVGLALELNQT-------------- 322
            .     ::..|..:|               |||:.|:|..::|.||.|...              
  Fly    74 AAKPGKEETIKWYEGTGEPFSNTRPPFVFKVAYIVFEKNSSIGKALALKSIDLFNSSGECIVKTG 138

  Fly   323 ------------LLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSK------TKAKNQNSAG 369
                        |||.:.   .:.|:.|..|...:...||:.|:||...      |..|...:||
  Fly   139 MELWHEEYDCNYLLDAQK---TKLQISKYMAGYDKRERAAAQAAKTGEADADGWVTVGKEGRNAG 200

  Fly   370 AKK------RLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDGIKKAKKPKKK 417
            .::      ||::|..|.|.:.:.:...|.|.::|:.:.: |:..||.::.|:|
  Fly   201 FEQKASVIGRLEEKVAKGNKTKELKNFYTFQIRESKMQNI-VEMRKKFEEEKRK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 2/2 (100%)
RRM_SF 261..332 CDD:302621 23/116 (20%)
CG9107NP_608981.1 RRM_Rrp7A 42..146 CDD:240740 21/103 (20%)
RRP7_Rrp7A 138..266 CDD:240578 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.