DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Cstf2t

DIOPT Version :10

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001101056.1 Gene:Cstf2t / 309338 RGDID:1310026 Length:629 Species:Rattus norvegicus


Alignment Length:99 Identity:30/99 - (30%)
Similarity:51/99 - (51%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 KQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPD-AV 313
            :.|:...:.|::|||::.|.||||||::|||..|.:...|.:.|.:.| .||..:..:|..: |:
  Rat     7 RDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETAL 71

  Fly   314 GLALELNQTLLDDRPINVE-------RYQVKKLG 340
            .....||......|.:.|:       :.::|.||
  Rat    72 SAMRNLNGREFSGRALRVDNAASEKNKEELKSLG 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828
RRM_SF 261..332 CDD:473069 24/72 (33%)
Cstf2tNP_001101056.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 26/83 (31%)
CSTF2_hinge 112..191 CDD:433869
CSTF_C 585..625 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.