DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and elavl4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001231529.1 Gene:elavl4 / 30737 ZFINID:ZDB-GENE-990415-246 Length:411 Species:Danio rerio


Alignment Length:290 Identity:61/290 - (21%)
Similarity:107/290 - (36%) Gaps:79/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 APKEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAKA-------NANNKDEEGVK 145
            |.|.:.|:|:..:         ..:|.:.|..||.......|..:::       ..:|.|.:   
Zfish    35 AEKGLLTQPKMII---------SNMEPQVTNGPNSATANGPSSNSRSCPSPMQTGGSNDDSK--- 87

  Fly   146 RIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAY- 209
                     :.:.|..||.|..:.:...||...|.::|.:|           .:.|:.|....| 
Zfish    88 ---------TNLIVNYLPQNMTQEEFRSLFGSIGEIESCKL-----------VRDKITGQSLGYG 132

  Fly   210 -VVLEKPEIAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSAT 272
             |....|:.|::|: .|||...:...::|:         .|:....|.:||  .::|..|..:.|
Zfish   133 FVNYIDPKDAEKAINTLNGLRLQTKTIKVS---------YARPSSASIRDA--NLYVSGLPKTMT 186

  Fly   273 EEQLREIFSSCGEIDYIRCLQD----GDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINVER 333
            :::|.::||..|.|...|.|.|    ...|.:||.::.|                  |:.|..|.
Zfish   187 QKELEQLFSQYGRIITSRILVDQVTGPTGGSRGVGFIRF------------------DKRIEAEE 233

  Fly   334 YQVKKLGAKQVRDAA---AASAASKTSSKT 360
             .:|.|..::...||   ....|:..|.||
Zfish   234 -AIKGLNGQKPSGAAEPITVKFANNPSQKT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 19/84 (23%)
RRM_SF 261..332 CDD:302621 17/74 (23%)
elavl4NP_001231529.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..89 7/50 (14%)
ELAV_HUD_SF 85..410 CDD:273741 51/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.