DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Pabpc4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_006238860.1 Gene:Pabpc4 / 298510 RGDID:1305015 Length:660 Species:Rattus norvegicus


Alignment Length:332 Identity:79/332 - (23%)
Similarity:128/332 - (38%) Gaps:95/332 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRL-------RTAGGKQLFKHKQRKVAGSLNAYVVL 212
            ::::||:|..:.....|.:.|.|.|.|.|||:       |:.|                .|||..
  Rat    11 ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLG----------------YAYVNF 59

  Fly   213 EKPEIAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPS-DKDAKRTIFVGSLKYSATEEQ 275
            ::|..|::|| .:|....|...:|:          ....:.|| .|.....:|:.:|..|...:.
  Rat    60 QQPADAERALDTMNFDVIKGKPIRI----------MWSQRDPSLRKSGVGNVFIKNLDKSIDNKA 114

  Fly   276 LREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERYQVKK- 338
            |.:.||:.|.|...:.:.| :.|.||.|:|.|:..:|...|:| :|..||:||.:.|.|::.:| 
  Rat   115 LYDTFSAFGNILSCKVVCD-ENGSKGYAFVHFETQEAANKAIEKMNGMLLNDRKVFVGRFKSRKE 178

  Fly   339 ----LGAKQ-----------------------------------VRDAAAASAASKTSSKTKAKN 364
                ||||.                                   :||.:..|......|..|.::
  Rat   179 REAELGAKAKEFTNVYIKNFGEEVDDENLRELFSQFGKTLSVKVMRDCSGKSKGFGFVSYEKHED 243

  Fly   365 QNSA----GAKKRLDK--------KKGKENGSLKKEGAPTGQKKKSEYRGVKV------DGIKKA 411
            .|.|    ..|:...|        ||.:....||::.....|::.|.|:||.:      |.|...
  Rat   244 ANKAVEEMNGKEMSGKSIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKNLDDTIDDE 308

  Fly   412 KKPKKKS 418
            |..|:.|
  Rat   309 KLRKEFS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 23/89 (26%)
RRM_SF 261..332 CDD:302621 23/71 (32%)
Pabpc4XP_006238860.1 PABP-1234 11..640 CDD:130689 79/332 (24%)
RRM1_I_PABPs 12..91 CDD:240824 23/104 (22%)
RRM2_I_PABPs 97..172 CDD:240825 24/75 (32%)
RRM3_I_PABPs 190..269 CDD:240826 9/78 (12%)
RRM4_I_PABPs 293..370 CDD:240827 7/23 (30%)
PABP 572..639 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.