DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Pabpc1l

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_038962521.1 Gene:Pabpc1l / 296351 RGDID:1563142 Length:669 Species:Rattus norvegicus


Alignment Length:250 Identity:63/250 - (25%)
Similarity:114/250 - (45%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIR-LRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIA 218
            :.::|.||.::.....|..||..:|..||:: :|.:.|       |.:..|.:|    .||.|.|
  Rat   191 TNIYVKNLRVDMDEQGLQDLFSQFGKTQSVKVMRDSNG-------QSRGFGFIN----FEKHEEA 244

  Fly   219 QQAL-ALNGSEFKENHLRVTPA-SMAEKFGQAKDKQPSDKDAKR------TIFVGSLKYSATEEQ 275
            |:|: .:||.|.....|.|..| ..||:..:.|.:....|..::      .::|.:|..|..:::
  Rat   245 QKAVDHMNGKEVSGQLLYVGRAQKRAERQNELKRRFEQMKQERQNRYQGVNLYVKNLDDSINDDR 309

  Fly   276 LREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKP-DAVGLALELNQTLLDDRPINV----ERYQ 335
            |:|:||:.|.|...:.:.:.... ||..:|||..| :|.....|:|..::..:|:.|    .:.:
  Rat   310 LKEVFSTYGVITSAKVMTESSHS-KGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEE 373

  Fly   336 VKKLGAKQVRDAAAASAASK----TSSKTKAKNQNSAGAKKRLDKKKGKENGSLK 386
            .|.:...|.|...:.|..|.    ||....|.:|.:...:.||.::...:.||::
  Rat   374 RKAILTNQYRRRLSRSVLSSFQQPTSYLLPAVHQVTGCLQLRLREQNVTDRGSVE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/83 (29%)
RRM_SF 261..332 CDD:302621 20/75 (27%)
Pabpc1lXP_038962521.1 PABP-1234 11..656 CDD:130689 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.