DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and pabp

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_593377.1 Gene:pabp / 2541505 PomBaseID:SPAC57A7.04c Length:653 Species:Schizosaccharomyces pombe


Alignment Length:385 Identity:83/385 - (21%)
Similarity:139/385 - (36%) Gaps:83/385 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNKDEEGV 144
            ||||.:.....::.|..||   ||| :||:|......|....||...:....|:.:.:.......
pombe     6 LKKQADAAVESDVNTNNEA---VES-STKEESSNTPSTETQPEKKAEEPEAAAEPSESTSTPTNA 66

  Fly   145 KRIRNPAEEAST---VFVGNLPINTKRVQLVKLFQPYGLVQSIRL-RTAGGKQLFKHKQRKVAGS 205
            ..:..|:..|.|   ::||.|..:.....|.:||...|.|.|||: |.|..::...:        
pombe    67 SSVATPSGTAPTSASLYVGELDPSVTEAMLFELFNSIGPVASIRVCRDAVTRRSLGY-------- 123

  Fly   206 LNAYVVLEKPEIAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPS-DKDAKRTIFVGSLK 268
              |||.....|..::|| .||.:..|....|:          ....:.|| .|.....:|:.:|.
pombe   124 --AYVNFHNMEDGEKALDELNYTLIKGRPCRI----------MWSQRDPSLRKMGTGNVFIKNLD 176

  Fly   269 YSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LNQTLLDDRPI--- 329
            .:...:.|.:.||:.|:|...:...|.....||..:|.|...::...|:| :|..||:|:.:   
pombe   177 PAIDNKALHDTFSAFGKILSCKVAVDELGNAKGYGFVHFDSVESANAAIEHVNGMLLNDKKVYVG 241

  Fly   330 -----------------NVERYQVKKLGA----KQVRDAAAASAASKTSSKTKAKNQNSAG---- 369
                             |.....:|.|..    ::..|.........:.|..|.:|....|    
pombe   242 HHVSRRERQSKVEALKANFTNVYIKNLDTEITEQEFSDLFGQFGEITSLSLVKDQNDKPRGFGFV 306

  Fly   370 -------AKKRLD-----------------KKKGKENGSLKKEGAPTGQKKKSEYRGVKV 405
                   |:|.:|                 :||.:....|:|.......:|.::|:||.:
pombe   307 NYANHECAQKAVDELNDKEYKGKKLYVGRAQKKHEREEELRKRYEQMKLEKMNKYQGVNL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/86 (28%)
RRM_SF 261..332 CDD:302621 19/91 (21%)
pabpNP_593377.1 PABP-1234 80..642 CDD:130689 63/307 (21%)
RRM1_I_PABPs 81..160 CDD:240824 23/98 (23%)
RRM2_I_PABPs 166..242 CDD:240825 18/75 (24%)
RRM3_I_PABPs 260..339 CDD:240826 10/78 (13%)
RRM4_I_PABPs 363..441 CDD:240827 2/4 (50%)
PolyA 581..644 CDD:197769
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.