DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and SPBC365.04c

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_596033.1 Gene:SPBC365.04c / 2540924 PomBaseID:SPBC365.04c Length:233 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:63/255 - (24%)
Similarity:103/255 - (40%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KLSAKDLAKIE--KKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPN 121
            |||.|.|..:|  .||..|::|.|::.:.|:..|    ..|.:.|...|.::.|..||: ....|
pombe     4 KLSKKKLKSLEYRSKKFDKKSQSLEEHEKKVQQK----NEELEKKAADKISRDELPEKQ-LAQSN 63

  Fly   122 EKPKGKVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRL 186
            :|.|..||........:|.::|....|.     ..:||||||.::....|...|:..|.|.|:|:
pombe    64 DKDKHSVSNPPHKTLKSKRQKGKNNDRK-----VILFVGNLPKDSSVETLQLHFKRAGQVPSVRI 123

  Fly   187 RTAGGKQLFKHKQRKVAGSLNAYVVLE----KPEIAQQALALNGSEFKENHLRV---------TP 238
            .|           .|.:|....|..:|    |.::..:||..:.:.:||..:.:         |.
pombe   124 PT-----------DKTSGRQKGYAFVEFINPKTDVISKALKFHHTIYKERKINIELTAGGGGKTE 177

  Fly   239 ASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCG-----EIDYIRCLQ 293
            |.|    .:.|:|....|:..|.......:.:..|:..|:..:..|     ..|.:|.||
pombe   178 ARM----NKIKEKNRKWKEEMRQRVASEEQQAGEEKMARKAVADEGLESGIHPDRLRLLQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/94 (23%)
RRM_SF 261..332 CDD:302621 7/38 (18%)
SPBC365.04cNP_596033.1 RRM 18..229 CDD:223796 54/235 (23%)
RRM_Nop6 92..167 CDD:240846 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.