DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and sce3

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_595728.1 Gene:sce3 / 2540528 PomBaseID:SPBC18H10.04c Length:388 Species:Schizosaccharomyces pombe


Alignment Length:304 Identity:60/304 - (19%)
Similarity:96/304 - (31%) Gaps:103/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PEIAQQALALNGSEFKENHLRVTPASMAE---KFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQL 276
            |..|........|.|:.  :|..|.|..|   ..|..:|..|...:...|..||:|.:..||..|
pombe    48 PSSADAGYNAPSSTFES--VRSPPESRREGGMGSGYQRDAIPIPSEPPFTAHVGNLSFDLTENDL 110

  Fly   277 REIFSSCGE-IDYIRCLQDG-DKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINV-------- 331
            .:.|   || :..||.:.|. .:..:|..||.|:..|.:..||.|:...|..||:.:        
pombe   111 GDFF---GEGVTSIRLVIDPLTERSRGFGYVEFETADTLSAALALSGEDLMGRPVRITVAEPRRS 172

  Fly   332 ----------------------------------------------------------------- 331
                                                                             
pombe   173 FAREERSTGDWVRRGPLPPAEPAESPFGKRRTNSGRFRDPARDPSDRVREEPREWVRRGPLPPRE 237

  Fly   332 ----ERYQVKKLGAKQVRDAAAASAASKTSSKTK------AKNQNSAGAKKRLDKKKGKENGSLK 386
                .|..:|...:..|...|..||.:.||||.|      ||..::....:|:::|..|...|.:
pombe   238 SSERPRLNLKPRSSSNVNTEATPSATTTTSSKPKRDPFGGAKPVDNTSVLQRVEEKLAKRTQSFR 302

  Fly   387 KEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKSNDQQTALAKKIA 430
            :|.....::..|          :|....|.:..|:..|:|:|::
pombe   303 REDNANRERSTS----------RKPSADKAEKTDKTDAIAEKVS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 5/21 (24%)
RRM_SF 261..332 CDD:302621 24/149 (16%)
sce3NP_595728.1 RRM 1..255 CDD:223796 37/211 (18%)
RRM_SF 95..169 CDD:302621 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.