DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and RBM34

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:432 Identity:132/432 - (30%)
Similarity:192/432 - (44%) Gaps:107/432 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KTPKAKESEKAEL--KPIKKEPGVVEDGKVTKKSKTKPKKKTVKVPKDEVKAAVQESPKKLSAKD 64
            ||.:.:|.|....  :|:.:||.          .|.|.|||.....|   |.|.:||  .|::.|
Human    81 KTKRNEEEESTSQIERPLSQEPA----------KKVKAKKKHTNAEK---KLADRES--ALASAD 130

  Fly    65 LAKIEKKKAKKQAQKLKKQQN--KLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKGK 127
            |   |::..:||.||.|..|.  |:|.::|..:.|..|                           
Human   131 L---EEEIHQKQGQKRKNSQPGVKVADRKILDDTEDTV--------------------------- 165

  Fly   128 VSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRT---A 189
            ||::.|...|.::|    |::|    ..||||||||:...:.:|...|:.||.::|:|.|:   |
Human   166 VSQRKKIQINQEEE----RLKN----ERTVFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSLIPA 222

  Fly   190 GG---KQL--FKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKEN-HLRVTPASMAEKFGQA 248
            .|   |:|  .|.|......::|||||.::...|.|||..||::..:. .:||..||        
Human   223 EGTLSKKLAAIKRKIHPDQKNINAYVVFKEESAATQALKRNGAQIADGFRIRVDLAS-------- 279

  Fly   249 KDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGC-KGVAYVCFQKPDA 312
               :.|.:| ||::|||:|.|...|..:.:.|..||.|..:|.::|...|. ||..||.|:..|:
Human   280 ---ETSSRD-KRSVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDS 340

  Fly   313 VGLALELNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDK- 376
            |.|||:||.:.|..|.:.|.|                      :.:|.|.|.|||....|.:.| 
Human   341 VHLALKLNNSELMGRKLRVMR----------------------SVNKEKFKQQNSNPRLKNVSKP 383

  Fly   377 KKGKENGSLKKEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKS 418
            |:|....|...||.|     ||.:.|.|...:|..||.:|||
Human   384 KQGLNFTSKTAEGHP-----KSLFIGEKAVLLKTKKKGQKKS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 33/90 (37%)
RRM_SF 261..332 CDD:302621 27/71 (38%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153 7/18 (39%)
RRM 176..>382 CDD:223796 79/247 (32%)
RRM1_RBM34 185..276 CDD:240840 33/90 (37%)
RRM2_RBM34 288..360 CDD:240841 27/71 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395 11/29 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430 6/10 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BIWG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4728
Isobase 1 0.950 - 0 Normalized mean entropy S2864
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004008
OrthoInspector 1 1.000 - - oto90470
orthoMCL 1 0.900 - - OOG6_103046
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R827
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.