DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Rbm11

DIOPT Version :10

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_938044.1 Gene:Rbm11 / 224344 MGIID:2447622 Length:238 Species:Mus musculus


Alignment Length:120 Identity:39/120 - (32%)
Similarity:64/120 - (53%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLAL 317
            |:.::|.||:|||:|:....||.|.|:|...|.:..:...:|.|...|...:|||:.|::|..|:
Mouse     3 PAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTLCKDRDGKPKSFGFVCFKHPESVSYAI 67

  Fly   318 E-LNQTLLDDRPINVERYQVKKLGAKQVRDAAAAS--AASKTSSKTKAKNQNSAG 369
            . ||...|..|||||:    .:.|:.:..:.|..|  :.:|.:|.: .:|...||
Mouse    68 ALLNGIRLYGRPINVQ----YRFGSSRSSEPANQSFESCAKINSHS-FRNDEMAG 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828
RRM_SF 261..332 CDD:473069 27/71 (38%)
Rbm11NP_938044.1 RRM_RBM11 9..83 CDD:410006 28/73 (38%)
PABP-1234 <12..209 CDD:130689 35/111 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..238
Bipartite nuclear localization signal. /evidence=ECO:0000305 202..237
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.