DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and sf3b4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_705947.3 Gene:sf3b4 / 192318 ZFINID:ZDB-GENE-020419-22 Length:400 Species:Danio rerio


Alignment Length:225 Identity:64/225 - (28%)
Similarity:94/225 - (41%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLE--KPEI 217
            :||:||.|........|.:||...|.|.:..:           .:.:|.|....|..:|  ..|.
Zfish    13 ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHM-----------PKDRVTGQHQGYGFVEFLSEED 66

  Fly   218 AQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFS 281
            |..|: .:|..:.....:||..||...|          :.|....||:|:|.....|:.|.:.||
Zfish    67 ADYAIKIMNMIKLYGKPIRVNKASAHNK----------NLDVGANIFIGNLDPEIDEKLLYDTFS 121

  Fly   282 SCGEI-DYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERYQVKKLGAKQ 343
            :.|.| ...:.::|.|.| .||.|::.|...||...|:| :|...|.:|||.|. |..|| .:|.
Zfish   122 AFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVS-YAFKK-DSKG 184

  Fly   344 VRDAAAAS---AASKTSSKTKAKNQNSAGA 370
            .|..:||.   ||....|:....:|..|.|
Zfish   185 ERHGSAAERLLAAQNPLSQADRPHQLFADA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 19/84 (23%)
RRM_SF 261..332 CDD:302621 26/73 (36%)
sf3b4NP_705947.3 RRM1_SF3B4 15..88 CDD:240780 19/83 (23%)
RRM2_SF3B4 99..181 CDD:240781 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.