powered by:
Protein Alignment CG12288 and T08B6.1
DIOPT Version :9
Sequence 1: | NP_609822.1 |
Gene: | CG12288 / 35027 |
FlyBaseID: | FBgn0032620 |
Length: | 435 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500665.2 |
Gene: | T08B6.1 / 188275 |
WormBaseID: | WBGene00020351 |
Length: | 96 |
Species: | Caenorhabditis elegans |
Alignment Length: | 96 |
Identity: | 22/96 - (22%) |
Similarity: | 31/96 - (32%) |
Gaps: | 39/96 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TPKA----KESEKAELKPIK---------------------------KEPGVVEDGKVTKK---- 32
||:| ..||:||:..:| .:||. ||.|..
Worm 2 TPQAINNNHTSEEAEMALLKLAQCASALVLSGFKFRNRKVTVTTKRTNKPGF---GKTTASRSQC 63
Fly 33 -SKTKPKKKTVKVPKDEVKAAVQESPKKLSA 62
:|.:|.::...|....|.|.|.....|.||
Worm 64 HAKPRPGQRVTIVKYVNVNATVNVFKSKRSA 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12288 | NP_609822.1 |
RRM1_RBM34 |
155..237 |
CDD:240840 |
|
RRM_SF |
261..332 |
CDD:302621 |
|
T08B6.1 | NP_500665.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.