DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Pabpc1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_032800.2 Gene:Pabpc1 / 18458 MGIID:1349722 Length:636 Species:Mus musculus


Alignment Length:337 Identity:82/337 - (24%)
Similarity:135/337 - (40%) Gaps:95/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PAEEASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRL-------RTAGGKQLFKHKQRKVAGSLN 207
            |:...::::||:|..:.....|.:.|.|.|.:.|||:       |:.|                .
Mouse     6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLG----------------Y 54

  Fly   208 AYVVLEKPEIAQQAL-ALNGSEFKENHLRVTPASMAEKFGQAKDKQPS-DKDAKRTIFVGSLKYS 270
            |||..::|..|::|| .:|....|...:|:          ....:.|| .|.....||:.:|..|
Mouse    55 AYVNFQQPADAERALDTMNFDVIKGKPVRI----------MWSQRDPSLRKSGVGNIFIKNLDKS 109

  Fly   271 ATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERY 334
            ...:.|.:.||:.|.|...:.:.| :.|.||..:|.|:..:|...|:| :|..||:||.:.|.|:
Mouse   110 IDNKALYDTFSAFGNILSCKVVCD-ENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRF 173

  Fly   335 QVKK-----LGAK-------------------QVRD-----AAAASAASKTSSKTKAKN------ 364
            :.:|     |||:                   ::::     ..|.|....|....|:|.      
Mouse   174 KSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSF 238

  Fly   365 QNSAGAKKRLDKKKGKE-NG-------SLKKEGAPTGQKKKSE---------YRGVKV------D 406
            :....|:|.:|:..||| ||       :.||....|..|:|.|         |:||.:      |
Mouse   239 ERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDD 303

  Fly   407 GIKKAKKPKKKS 418
            ||...:..|:.|
Mouse   304 GIDDERLRKEFS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/89 (25%)
RRM_SF 261..332 CDD:302621 23/71 (32%)
Pabpc1NP_032800.2 PABP-1234 11..615 CDD:130689 81/332 (24%)
CSDE1-binding. /evidence=ECO:0000250 166..289 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.