DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and rbm-39

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_500025.1 Gene:rbm-39 / 176922 WormBaseID:WBGene00021921 Length:580 Species:Caenorhabditis elegans


Alignment Length:385 Identity:72/385 - (18%)
Similarity:139/385 - (36%) Gaps:89/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KSKTKPKKKTVKVPKDEVKAAVQESPKKLSAKDLAKIEKKKAKKQAQKLKKQQNKLAP---KEIK 93
            :|::|.::.|.:           .||.:  .:..::...:.|.::..:.:.:..:.:|   ::.:
 Worm    69 RSRSKDRRTTRR-----------RSPSR--ERRRSRSRDRGAPRRRSRTRSRDRRRSPPRRRDRR 120

  Fly    94 TEPE----AQVKVESKATKKEKVEKEPTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEA 154
            |.|.    .:....|:....|:.:..|....:..||   :.|.:..|..:|:.            
 Worm   121 TPPRRSPGRRSPPRSRLPGPERRDVMPFNPRHSPPK---NAKLELTAEERDQR------------ 170

  Fly   155 STVFVGNLPINTKRVQLVKLFQPYGLVQSIRL----RTAGGKQLFKHKQRKVAGSLNAYVVLEKP 215
             |:.:..:..:|:...|.:.|...|.|:.:|:    ||...|.:             .||.....
 Worm   171 -TLLIMQIARDTRPRDLEEFFSAVGAVRDVRIITDSRTGRSKGI-------------CYVEFWDE 221

  Fly   216 EIAQQALALNGSEFKENHL----------RVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYS 270
            |.....|||||.......|          |...:|:|...|..   .|.:|.... :.|.:|...
 Worm   222 ESVPLGLALNGQRLMGAPLQIQRTCAERNRAANSSVASTLGFV---APGNKGPTH-VLVENLHPK 282

  Fly   271 ATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALE-LNQTLLDDRPINVERY 334
            ..|:.:|:||.|.|.|:.|....|.::..:|.|.:.|:..|....:.| ||...|..|.|.:   
 Worm   283 IDEKMIRDIFESFGRIEKIDLEVDSNRENRGFATITFRNADDAQKSCEQLNNFELAGRCIRL--- 344

  Fly   335 QVKKLGAKQVRDAAAASAASKTSSKTKAKNQN----------SAGAKKRLDKKKGKENGS 384
                    .::..:.|.|..|..:....::.:          .||.:::|..|..:..||
 Worm   345 --------SIKQESQAPAVKKEEASIHQRSLDDVGDRQGFSLGAGGRQQLMAKLAQGTGS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 20/95 (21%)
RRM_SF 261..332 CDD:302621 21/71 (30%)
rbm-39NP_500025.1 RRM1_RBM39_like 171..243 CDD:240729 19/84 (23%)
RRM_SF 276..345 CDD:302621 21/79 (27%)
RBM39linker 367..438 CDD:292157 6/30 (20%)
RRM3_RBM39_like 421..505 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.