DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and rsp-3

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001370111.1 Gene:rsp-3 / 176688 WormBaseID:WBGene00004700 Length:258 Species:Caenorhabditis elegans


Alignment Length:298 Identity:51/298 - (17%)
Similarity:100/298 - (33%) Gaps:86/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 EASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEI 217
            |...|:|||||.:.:..::..:|..||.::.:.:::..|...             |:|..|....
 Worm     7 EDQKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAF-------------AFVEFEDHRD 58

  Fly   218 AQQAL-ALNGSEFKENHLRVT------PASMAEK----------------FGQAKDKQPSDKDAK 259
            |:.|: |.:|.||....:||.      |.....:                .|..:...|..:...
 Worm    59 AEDAVRARDGYEFDGRRIRVEFTRGVGPRGPGGRPLQDGGDHRGGDFRGGRGGGRGGGPQRRTGY 123

  Fly   260 RTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLL 324
            |.|..| |..:.:.:.|::.....|::.|....:||    .||                      
 Worm   124 RVIVEG-LPPTGSWQDLKDHMRDAGDVCYADVARDG----TGV---------------------- 161

  Fly   325 DDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSLKKEG 389
                :...||:..|...:::.|....|...:| :..:.:..||:|.                  |
 Worm   162 ----VEFTRYEDVKYAVRKLDDTKFRSHEGET-AYIRVREDNSSGG------------------G 203

  Fly   390 APTGQKKKSEYRGVKVDGIKKAKKPKKKSNDQQTALAK 427
            :..|.:.:|..|..:.:.....|...::|..:..:.::
 Worm   204 SGGGGRDRSRSRSPRAERRASPKYSPRRSRSRSRSRSR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 20/82 (24%)
RRM_SF 261..332 CDD:302621 10/70 (14%)
rsp-3NP_001370111.1 RRM1_SRSF1_like 10..80 CDD:409775 21/82 (26%)
RRM2_SRSF1_like 123..196 CDD:410013 17/104 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.