DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and tiar-2

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_496718.1 Gene:tiar-2 / 174909 WormBaseID:WBGene00012904 Length:434 Species:Caenorhabditis elegans


Alignment Length:258 Identity:62/258 - (24%)
Similarity:104/258 - (40%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KANANNKDEEGVKRIRNPAEEASTVFVGNL-PINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFK 196
            :.:|...:.||. ::.:.:|:..|:||.|| |..|... |..||...|.|...::       :|:
 Worm    19 RVHARIAEREGF-QLASGSEDPRTLFVANLDPAITDEF-LATLFNQIGAVMKAKI-------IFE 74

  Fly   197 HKQRKVAGSLNAYVVLEKPEIAQQALAL---NGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDA 258
                   |..:.|..:|..:..|..|||   ||.|..|..:.||.|....:.|:.:.|..:.:..
 Worm    75 -------GLNDPYAFVEFSDHNQATLALQSHNGRELLEKEMHVTWAFEPREPGENRSKPETSRHF 132

  Fly   259 KRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDG--DKGCKGVAYVCF-QKPDAVGLALELN 320
            .  :|||.|.......:|||.|...||:...:.::|.  :|| ||..:|.: ::.||.....|:|
 Worm   133 H--VFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKG-KGYGFVSYPRREDAERAIDEMN 194

  Fly   321 QTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENG 383
            ...|..|.|                         :|:..|:..:::......|.|::.|...|
 Worm   195 GAWLGRRTI-------------------------RTNWATRKPDEDGERGGDRGDRRGGGGGG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/85 (28%)
RRM_SF 261..332 CDD:302621 23/73 (32%)
tiar-2NP_496718.1 RRM 36..321 CDD:223796 59/240 (25%)
RRM_SF 42..113 CDD:302621 25/85 (29%)
RRM_SF 133..207 CDD:302621 24/101 (24%)
RRM3_TIA1_like 256..326 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.