DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and EEED8.4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_495022.2 Gene:EEED8.4 / 173921 WormBaseID:WBGene00017135 Length:191 Species:Caenorhabditis elegans


Alignment Length:107 Identity:30/107 - (28%)
Similarity:56/107 - (52%) Gaps:7/107 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 MAEKFGQAKDKQPSDKDAK----RTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDG-DKGCK 300
            ||:....|....|::::.|    :::|:|::.:::|.|::.|.|..||:|......:|. .|..|
 Worm    32 MAKHLESAAYVPPTEEEQKAIDAKSVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQK 96

  Fly   301 GVAYVCFQKPDAVGLALELNQTLLDDRPINV--ERYQVKKLG 340
            ..||:.|....::..||.:|.:|...|||.|  :|..:..:|
 Worm    97 NFAYIEFDDSSSIENALVMNGSLFRSRPIVVTAKRTNIPGMG 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840
RRM_SF 261..332 CDD:302621 23/73 (32%)
EEED8.4NP_495022.2 RRM <2..>127 CDD:223796 27/94 (29%)
RRM_II_PABPs 56..128 CDD:240752 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R827
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.