powered by:
Protein Alignment CG12288 and R06C1.4
DIOPT Version :9
Sequence 1: | NP_609822.1 |
Gene: | CG12288 / 35027 |
FlyBaseID: | FBgn0032620 |
Length: | 435 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493029.1 |
Gene: | R06C1.4 / 173076 |
WormBaseID: | WBGene00011059 |
Length: | 84 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 21/73 - (28%) |
Similarity: | 41/73 - (56%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 TIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAVGLALE-LNQTL 323
:::||::.|..|||::...|::.|.::.:|.:.|.:.| .:|.|:|.|.:......|:| ||...
Worm 7 SVYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLNGVA 71
Fly 324 LDDRPINV 331
.:.|.:.|
Worm 72 FNGRNLRV 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12288 | NP_609822.1 |
RRM1_RBM34 |
155..237 |
CDD:240840 |
|
RRM_SF |
261..332 |
CDD:302621 |
21/73 (29%) |
R06C1.4 | NP_493029.1 |
RRM_SF |
9..84 |
CDD:388407 |
21/71 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.