DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and ztf-4

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_491976.2 Gene:ztf-4 / 172422 WormBaseID:WBGene00020399 Length:367 Species:Caenorhabditis elegans


Alignment Length:322 Identity:59/322 - (18%)
Similarity:103/322 - (31%) Gaps:111/322 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TEPEAQVKVESKAT-----KKEKVEKEPTTAP-----NEKPKGKVSKKAKANANNKDEEGVKRIR 148
            |.|.|.:.....||     ::....::.|.||     |......|:.....:.::||...::   
 Worm    21 TTPAAALAASIPATSVYGEQRPTFSEDGTGAPYSTILNLVGSAAVNSDISYDTSSKDPHMIR--- 82

  Fly   149 NPAEEASTVFVGNL--PINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVV 211
                  :.||:||:  .|.| |..:::||:|:|.:.::......|   |...|...|||.:    
 Worm    83 ------ARVFIGNIARAIIT-RDDIIELFRPFGKIIAVNYFAQQG---FGFVQFNEAGSAD---- 133

  Fly   212 LEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQL 276
                   :...:|||..:|...|.|..|                       .:|||:...     
 Worm   134 -------ESCRSLNGMSWKACCLDVHLA-----------------------MLGSLRKPT----- 163

  Fly   277 REIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQKPDAVGLALELNQTLLD------DRPINVERYQ 335
                              |::|.:|....    |..:.:...|.|..:|      .||...|.|:
 Worm   164 ------------------GNEGRQGNTIA----PAPLPVGKPLTQHAVDTSAQSAKRPYEDEEYE 206

  Fly   336 VKKLGAKQVRDAAAASAASK-------------------TSSKTKAKNQNSAGAKKRLDKKK 378
            :.|...:..:.|...:..::                   ||...:.|....||..|..|.::
 Worm   207 IFKQNKRNKQFANGDTTINEQLAPNEMCDTMVCGYCRFVTSDFEEFKEHRIAGCNKYKDPEE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/83 (27%)
RRM_SF 261..332 CDD:302621 12/76 (16%)
ztf-4NP_491976.2 RRM <64..272 CDD:223796 50/279 (18%)
RRM_SF 83..151 CDD:388407 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.